Uso del Trenbolone nelle donne

trenw

Del Trenbolone ho parlato approfonditamente in diversi articoli, ne ho descritto le caratteristiche e le applicazioni sottolineandone i pro e i contro. In questo articolo vorrei trattare brevemente una pratica d’uso del Trenbolone che in passato mi sono trovato ad osteggiare, e cioè  l’uso di questo AAS in ambito femminile.

 

 

Per trattare questo argomento con la giusta obbiettività occorre fare un breve ripasso delle caratteristiche base di questa molecola.

Trenbolone_svg
Trenbolone

 

Il Trenbolone (17β-Hydroxyestra-4,9,11-trien-3-one), sintetizzato nel 1963 da Veluz et al.(1), è un 19 nor- steroide derivato dal Nandrolone, condividendo quindi con il suo precursore l’alterazione in C-19 della molecola . Il Trenbolone differisce dal suo precursore (Nandrolone) per:

1- Il doppio legame inserito in C9– C10, che inibisce totalmente l’aromatizzazione e aumenta la resistenza al passaggio epatico;

2- l’insaturazione in C11-C12 che aumenta l’affinità per il recettore androgeno, rendendo il Trenbolone uno degli anabolizzante con la più forte affinità AR. (2)

Agli inizi del 1970, il Trenbolone è stato venduto come farmaco veterinario iniettabile (Trenbolone Acetato) in Inghilterra dalla Hoechst con il nome di Finajet, e in Francia come Finaject dalla Roussel. La Roussel AG in Germania è stata il genitore per entrambe le società. Sempre negli anni ’70, Il Trenbolone vide il suo debutto come farmaco da prescrizione per uso umano. La forma esterificata di Trenbolone commercializzato per uso umano era il Trenbolone Hexahydrobenzylcarbonato, sviluppato dalla Negma Laboratoires in Francia, la quale ha venduto il farmaco con il nome commerciale di Parabolan. È stato inoltre venduto per un periodo di tempo con il nome di Hexabolan, un nome che richiama all’estere. Il Trenbolone Hexahydrobenzylcarbonato è l’unica forma nota di Trenbolone mai prodotto come farmaco per uso umano.

para1

Il Parabolan è stato prescritto in Francia come agente anabolizzante per il risparmio proteico in caso di cachessia (deperimento della massa magra) e nella malnutrizione, oltre che per combattere alcune forme di osteoporosi. Le sue linee guida di prescrizione includevano  raccomandazioni per il trattamento delle popolazioni androgeno-sensibile, come le donne e gli anziani. Grazie alle sue spiccate proprietà androgene, tuttavia, il farmaco è stato controindicato nei bambini, e soprattutto nelle giovani donne. Il Parabolan è rimasto sul mercato francese per un tempo molto lungo, anche se è stato interrotto (volontariamente) dalla Negma nel 1997.

Il Parabolan era generalmente somministrato ad un dosaggio clinico pari a 3 fiale al mese (228mg). La terapia veniva avviata il primo mese con tutte e 3 le fiale somministrate nel corso dei primi 15 giorni. Durante i successivi 3 mesi, veniva somministrata una iniezione (76 mg) ogni 10 giorni. Queste linee guida di trattamento erano applicate anche alle donne.

E’ corretto tenere a mente che il valore Anabolico/Androgeno del Trenbolone rispetto al Testosterone (100/100) è pari a 625:185.

Come si può osservare, Il Trenbolone possiede una spiccata attività androgena anche se, il suo indice terapeutico, ovvero il rapporto tra valore anabolizzante e valore androgeno, è pari a 3,4 (eguale a quello del Nandrolone). Nonostante ciò, le atlete di sesso femminile possono incorrere in effetti collaterali androgenici molto forti tra i quali troviamo approfondimento della voce, irregolarità mestruale, cambiamenti nella struttura della pelle,  crescita di peli sul viso, alopecia, e ipertrofia clitoridea. Per ovviare a questo, le donne devono prestare particolare attenzione alle dosi somministrate.

2025350_2014olympiamsolympiapreviewgraphicsirisalina_jpeg82780deb1c1418acefa140d481ae766c

Il Trenbolone viene sempre più utilizzato dalle donne a dosi controllate (sebbene i “preparatori” sconsiderati non manchino). Il fatto che la molecola presenta spiccate caratteristiche di aumento della massa magra e di riduzione della massa grassa, hanno fatto si che questo composto diventasse un attrattiva anche per le atlete. Quando le utilizzatrici vengono interrogate sul loro uso di Trenbolone riportano una varietà di dosaggio abbastanza eterogenea e, ovviamente,  dipendente dall’estere utilizzato.  In genere si parte da un dosaggio molto contenuto di 10mg (estere Acetato) a giorni alterni fino ad arrivare ad un dosaggio di  100mg / settimana suddiviso in due dosi eguali. Le atlete di alto livello impegnate in competizioni importanti hanno riportato l’uso in combinazione di Trenbolone con Testosterone Propionato. Un altro uso del Trenbolone che è stato riportato in ambito femminile consiste nell’assunzione del farmaco negli ultimi 3-4 giorni precedenti alla gara per aggiungere durezza e definizione.  Generalmente, e per ovvie ragioni, le atlete optano per l’uso del Trenbolone Acetato che, con la sua breve emivita, risulta essere più gestibile. Con questo estere l’uso più comune consiste nell’iniezione di 10mg del AAS a giorni alterni (per un totale di 40-30mg a settimana)  per un periodo limitato a 4-6 settimane. Per assicurarsi una dose precisa, è consigliato l’uso di siringhe da Insulina. Con esteri più lunghi (Trenbolone Enantato e Hexahydrobenzylcarbonato) le dosi comunemente riportate in ambito femminile rientrano nel range dei 76mg divisi in due dosi da 38mg distanziate da 4 giorni l’una dall’altra (Trenbolone Hexahydrobenzylcarbonato) o dei 100mg divisi in due dosi da 50mg distanziate da 4 giorni l’una dall’altra (Trenbolone Enantato)  per un totale di 6 settimane. Questi dosaggi sono discretamente conservativi e volti ad evitare la comparsa di gravi effetti collaterali virilizzanti.

Le atlete di sesso femminile più esperte usano il Trenbolone in off-season in modo da cogliere i benefici dati dalla molecola sulla crescita della massa muscolare mantenendo al tempo stesso la percentuale di grasso corporeo relativamente bassa (dieta dipendente). D’altro canto, l’uso di questo AAS viene applicato da queste atlete anche  durante la preparazione alla gara dove le aiuterà a preservare la massa muscolare precedentemente guadagnata e ridurre marcatamente la massa grassa, mentre stanno seguendo una dieta ipocalorica. Le atlete più spesso inseriscono il Trenbolone durante le ultime settimane di preparazione alla gara o addirittura ne limitano l’uso alla settimana prima dell’esibizione – con un programma di iniezioni più frequente.

mascolinizzanti

E’ corretto riportare che gli effetti collaterali virilizzanti sono stati sperimentati a diverso grado con tutte le pratiche sopra menzionate – solitamente sotto forma di aumentata della peluria e acne – e la gravità degli effetti collaterali sembrava essere peggiore nelle donne più giovani. La teoria volta a spiegare tale fenomeno ricerca le cause nella funzione ovarica e nella sensibilità androgenica, dove una donna più giovane presenta una funzione ovarica più forte e una sensibilità androgenica più spiccata rispetto ad una donna più matura che può entrare in peri-menopausa: squilibri più marcati = effetti più marcati.  Ovviamente questa è semplicemente una speculazione ma sembra comunque essere una spiegazione plausibile. 

Le atlete, oltre agli effetti collaterali virilizzanti,  hanno anche sperimentato effetti collaterali quali  tachicardia dopo una sola iniezione, accompagnata da copiosa sudorazione notturna e da insonnia abbastanza grave. L’aumento dell’aggressività, similmente a quanto accade per gli atleti di sesso maschile,  è spesso una costante nelle atlete che usano Trenbolone .  

treninj

Comunque sia, la dose di Trenbolone considerata “migliore” dalle atlete in quanto a rischi/benefici è stata di 30mg/settimana (Trenbolone Acetato) divisa in tre somministrazioni (Lunedì-Mercoledì-Venerdì). Alcune atlete sono riuscite a contenere gli effetti virilizzanti con una dose settimanale di 90mg di Trenbolone Acetato (in tre dosi da 30mg), ma non è generalmente consigliato specie se si è alla prima esperienza con questa molecola. Torno a ripetere che, per la somministrazione di Trenbolone nelle atlete è raccomandato l’uso di una siringa per insulina così da ottenere dosaggi molto precisi e abbassare anche il rischio di creare tessuto cicatriziale. 

Non dobbiamo dimenticare che il Trenbolone è un potente androgeno che viene utilizzato principalmente nel bestiame, e nonostante la parentesi del Parabolan come farmaco per uso umano non abbiamo molte informazioni a nostra disposizione sull’effetto di questo composto sul sistema endocrino femminile rispetto ad altri  farmaci usati in passato o attualmente per trattare pazienti di sesso femminile.

Molto onestamente, in tale contesto il dosaggio di Trenbolone dipende principalmente da quanto una donna è disposta ad affrontare i possibili effetti collaterali. Non esiste una dose efficace di Trenbolone che ci garantisca in assoluto una protezione dalla possibile comparsa di effetti collaterali virilizzanti. Inoltre, le atlete sono soggette agli effetti collaterali molto conosciuti dagli uomini con l’uso di questa molecola, tra cui la riduzione dei livelli di TSH e, di conseguenza, la riduzione di T4 e T3, e possibile iper-prolattinemia.

Non si tratta di una molecola di facile gestione, tanto nell’uomo quanto nella donna. Di conseguenza, se né sconsiglia l’uso in atlete principianti/intermedie nell’uso della chimica e senza supervisione da parte di personale preparato in grado di gestire e applicare con le dovute precauzioni la molecola.

Gabriel Bellizzi

Riferimenti:

1- Velluz L, Nomine G et al. C R Acad Sci 1963;257:569.

2- Unique steroid congeners for receptor studies. Ojasoo, Raynaud. Cancer Research 38 (1978):4186-98.

Rispondi

Inserisci i tuoi dati qui sotto o clicca su un'icona per effettuare l'accesso:

Logo di WordPress.com

Stai commentando usando il tuo account WordPress.com. Chiudi sessione /  Modifica )

Foto Twitter

Stai commentando usando il tuo account Twitter. Chiudi sessione /  Modifica )

Foto di Facebook

Stai commentando usando il tuo account Facebook. Chiudi sessione /  Modifica )

Connessione a %s...